PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G112700.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 171aa    MW: 18544.9 Da    PI: 8.3615
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G112700.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.49e-42101091100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk lrrkC ++C+++pyfp e+p+kfa+vhk+FGasnv kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l
  Manes.17G112700.6.p  10 PCAACKSLRRKCLPNCIFSPYFPPEEPQKFAIVHKIFGASNVNKLLNEVLPHQREDAVKSLAYEAEARLKDPVYGCVGAISVLQSQVIKL 99 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el+++++ 
  Manes.17G112700.6.p 100 QKELDATQAD 109
                          ****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9559110IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4110107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MASSSYSISP CAACKSLRRK CLPNCIFSPY FPPEEPQKFA IVHKIFGASN VNKLLNEVLP  60
HQREDAVKSL AYEAEARLKD PVYGCVGAIS VLQSQVIKLQ KELDATQADL IRYASSSPSP  120
PSSVLFGRSR MGHGGSSSAS YDQNSVFYYP SPRSNETCGH TQERGDHGSI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072821.11e-86PREDICTED: LOB domain-containing protein 25
SwissprotQ8L8Q37e-62LBD25_ARATH; LOB domain-containing protein 25
SwissprotQ9FML48e-62LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A067LNI61e-86A0A067LNI6_JATCU; Uncharacterized protein
STRINGPOPTR_0001s35280.11e-85(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-62LBD family protein